PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00616.1.g00090.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 309aa    MW: 35077 Da    PI: 10.8972
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00616.1.g00090.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.91.7e-18165219256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ ++tkeq  +Le+ F+++++++ +++  LA++l+L  rqV vWFqNrRa++k
  Zpz_sc00616.1.g00090.1.am.mk 165 RKKLRLTKEQSAVLEDRFKEHSTLNPKQKVALANQLNLRPRQVEVWFQNRRARRK 219
                                   78889************************************************98 PP

2HD-ZIP_I/II116.91.2e-37165253190
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rl+keq+++LE+ F+e+++L+p++Kv+la++L+l+prqv+vWFqnrRAR k+kq E+d+e Lkr y++l+een+rL+
  Zpz_sc00616.1.g00090.1.am.mk 165 RKKLRLTKEQSAVLEDRFKEHSTLNPKQKVALANQLNLRPRQVEVWFQNRRARRKLKQAEVDCELLKRFYETLTEENRRLH 245
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLree 90 
                                    e ++Lr +
  Zpz_sc00616.1.g00090.1.am.mk 246 CELQRLR-A 253
                                   ******9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-18151222IPR009057Homeodomain-like
PROSITE profilePS5007117.006161221IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.6E-18163223IPR009057Homeodomain-like
SMARTSM003895.6E-16163225IPR001356Homeobox domain
CDDcd000861.81E-14165222No hitNo description
PfamPF000466.0E-16165219IPR001356Homeobox domain
PROSITE patternPS000270196219IPR017970Homeobox, conserved site
PfamPF021831.3E-7221254IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.0E-15221264IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MHLRPSTTPQ RRGAMVDGTR KRKVRRRNWI RWLDERKRLI RAARRPSRMA TGKRGRGGSE  60
RHRTRQREEY MEHEEVGLAL GLSLGSGHHW FKEQPPPPPS QLCALEPSMS ISIRADDGSL  120
PTQARPLNGA VKREFPVEDD DGPMDRGLYS VVSSAADDDE GCNSRKKLRL TKEQSAVLED  180
RFKEHSTLNP KQKVALANQL NLRPRQVEVW FQNRRARRKL KQAEVDCELL KRFYETLTEE  240
NRRLHCELQR LRALNHPHPA AFFMPGAALS ICPSCERLAS TPGAATATDR PKATGPAPLL  300
SNFTKSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12037KRKVRRRNWIRWLDERKR
2163169SRKKLRL
3213221RRARRKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983488.11e-109PREDICTED: homeobox-leucine zipper protein HOX15-like
SwissprotQ7G7371e-71HOX15_ORYSJ; Homeobox-leucine zipper protein HOX15
TrEMBLK4AE821e-108K4AE82_SETIT; Uncharacterized protein
STRINGSi037189m1e-108(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.13e-61HD-ZIP family protein